DAG1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A10076
Article Name: DAG1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10076
Supplier Catalog Number: A10076
Alternative Catalog Number: ABB-A10076-20UL,ABB-A10076-100UL,ABB-A10076-500UL,ABB-A10076-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: A3a, DAG, AGRNR, 156DAG, MDDGA9, MDDGC7, MDDGC9, LGMDR16, DAG1
This gene encodes dystroglycan, a central component of dystrophin-glycoprotein complex that links the extracellular matrix and the cytoskeleton in the skeletal muscle. The encoded preproprotein undergoes O- and N-glycosylation, and proteolytic processing to generate alpha and beta subunits. Certain mutations in this gene are known to cause distinct forms of muscular dystrophy. Alternative splicing results in multiple transcript variants, all encoding the same protein.
Clonality: Polyclonal
Molecular Weight: 97kDa
NCBI: 1605
UniProt: Q14118
Purity: Affinity purification
Sequence: RKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPLNQDTMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Target: DAG1
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|IF/ICC,1:20 - 1:100|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Neuroscience