alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb, Unconjugated

Artikelnummer: ABB-A1011
Artikelname: alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb, Unconjugated
Artikelnummer: ABB-A1011
Hersteller Artikelnummer: A1011
Alternativnummer: ABB-A1011-20UL,ABB-A1011-100UL,ABB-A1011-500UL,ABB-A1011-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ACTSA, alpha-Smooth Muscle Actin (ACTA2)
This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome.
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 59
UniProt: P62736
Reinheit: Affinity purification
Sequenz: MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI
Target-Kategorie: ACTA2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|IHC-P,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Actins,Death Receptor Signaling Pathway,Neuroscience,Neurodegenerative Diseases Markers,Other Neurological disorders,Stem Cells,Mesenchymal Stem Cells,Cardiovascular,Heart,Contractility