alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb, Unconjugated

Catalog Number: ABB-A1011
Article Name: alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1011
Supplier Catalog Number: A1011
Alternative Catalog Number: ABB-A1011-20UL,ABB-A1011-100UL,ABB-A1011-500UL,ABB-A1011-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ACTSA, alpha-Smooth Muscle Actin (ACTA2)
This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome.
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 59
UniProt: P62736
Purity: Affinity purification
Sequence: MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI
Target: ACTA2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|IHC-P,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Actins,Death Receptor Signaling Pathway,Neuroscience,Neurodegenerative Diseases Markers,Other Neurological disorders,Stem Cells,Mesenchymal Stem Cells,Cardiovascular,Heart,Contractility