Cytokeratin 9 (KRT9) Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10119
Artikelname: Cytokeratin 9 (KRT9) Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10119
Hersteller Artikelnummer: A10119
Alternativnummer: ABB-A10119-100UL,ABB-A10119-20UL,ABB-A10119-1000UL,ABB-A10119-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: K9, CK-9, EPPK, Cytokeratin 9 (KRT9)
This gene encodes the type I keratin 9, an intermediate filament chain expressed only in the terminally differentiated epidermis of palms and soles. Mutations in this gene cause epidermolytic palmoplantar keratoderma.
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 3857
UniProt: P35527
Reinheit: Affinity purification
Sequenz: TANEKSTMQELNSRLASYLDKVQALEEANNDLENKIQDWYDKKGPAAIQKNYSPYYNTIDDLKDQIVDLTVGNNKTLLDIDNTRMTLDDFRIKFEMEQNLRQGVDADINGLRQVLDNLTMEKSDLEMQYETLQEELMALKKNHKEEMSQLTGQNSGDVNVEINVAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQEVQSSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLEDTKNR
Target-Kategorie: KRT9
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Keratin