Cytokeratin 9 (KRT9) Rabbit pAb, Unconjugated

Catalog Number: ABB-A10119
Article Name: Cytokeratin 9 (KRT9) Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10119
Supplier Catalog Number: A10119
Alternative Catalog Number: ABB-A10119-100UL,ABB-A10119-20UL,ABB-A10119-1000UL,ABB-A10119-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: K9, CK-9, EPPK, Cytokeratin 9 (KRT9)
This gene encodes the type I keratin 9, an intermediate filament chain expressed only in the terminally differentiated epidermis of palms and soles. Mutations in this gene cause epidermolytic palmoplantar keratoderma.
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 3857
UniProt: P35527
Purity: Affinity purification
Sequence: TANEKSTMQELNSRLASYLDKVQALEEANNDLENKIQDWYDKKGPAAIQKNYSPYYNTIDDLKDQIVDLTVGNNKTLLDIDNTRMTLDDFRIKFEMEQNLRQGVDADINGLRQVLDNLTMEKSDLEMQYETLQEELMALKKNHKEEMSQLTGQNSGDVNVEINVAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQEVQSSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLEDTKNR
Target: KRT9
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Keratin