Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1015
• Hersteller Artikelnummer: A1015
• Alternativnummer: ABB-A1015-100UL,ABB-A1015-20UL,ABB-A1015-500UL,ABB-A1015-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PI, A1A, AAT, PI1, A1AT, nNIF, PRO2275, alpha1AT, Alpha-1 Antitrypsin (SERPINA1)

Produktbeschreibung

The protein encoded by this gene is a serine protease inhibitor belonging to the serpin superfamily whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. This protein is produced in the liver, the bone marrow, by lymphocytic and monocytic cells in lymphoid tissue, and by the Paneth cells of the gut. Defects in this gene are associated with chronic obstructive pulmonary disease, emphysema, and chronic liver disease. Several transcript variants encoding the same protein have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 47kDa
• NCBI: 5265
• UniProt: P01009
• Reinheit: Affinity purification
• Sequenz: EDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQH
• Target-Kategorie: SERPINA1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Endocrine Metabolism,Cardiovascular,Blood,Serum Proteins,Hypoxia

Bilder