CNPase Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: CNPase Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1018
• Hersteller Artikelnummer: A1018
• Alternativnummer: ABB-A1018-100UL,ABB-A1018-20UL,ABB-A1018-1000UL,ABB-A1018-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CNP1, HLD20, CNPase

Produktbeschreibung

Predicted to enable 2,3-cyclic-nucleotide 3-phosphodiesterase activity. Involved in substantia nigra development. Located in several cellular components, including extracellular space, microtubule, and plasma membrane. Implicated in hypomyelinating leukodystrophy 20, multiple sclerosis, and schizophrenia. Biomarker of alcoholic liver cirrhosis, multiple sclerosis, and restless legs syndrome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 48kDa
• NCBI: 1267
• UniProt: P09543
• Reinheit: Affinity purification
• Sequenz: PKTAWRLDCAQLKEKNQWQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQTGLDLLEILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPV
• Target-Kategorie: CNP
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience, Cell Type Marker,Neurodegenerative Diseases

Bilder