KIF4A Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10193
Artikelname: KIF4A Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10193
Hersteller Artikelnummer: A10193
Alternativnummer: ABB-A10193-100UL,ABB-A10193-20UL,ABB-A10193-1000UL,ABB-A10193-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: KIF4, KIF4G1, MRX100, XLID100, KIF4A
This gene encodes a member of the kinesin 4 subfamily of kinesin related proteins. The encoded protein is an ATP dependent microtubule-based motor protein that is involved in the intracellular transport of membranous organelles. This protein also associates with condensed chromosome arms and may be involved in maintaining chromosome integrity during mitosis. This protein may also be involved in the organization of the central spindle prior to cytokinesis. A pseudogene of this gene is found on chromosome X.
Klonalität: Polyclonal
Molekulargewicht: 140kDa
NCBI: 24137
UniProt: O95239
Reinheit: Affinity purification
Sequenz: LIGELVSSKIQVSKLESSLKQSKTSCADMQKMLFEERNHFAEIETELQAELVRMEQQHQEKVLYLLSQLQQSQMAEKQLEESVSEKEQQLLSTLKCQDEELEKMREVCEQNQQLLRENEIIKQKLTLLQVASRQKHLPKDTLLSPDSSFEYVPPKPKPSRVKEKFLEQSMDIEDLKYCSEHSVNEHEDGDGDDDEGDDEEWKPTKLVKVSR
Target-Kategorie: KIF4A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:3000|IHC-P,1:50 - 1:200|IF/ICC,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cytoskeleton,Motor Proteins