CLDN5 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: CLDN5 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A10207
• Hersteller Artikelnummer: A10207
• Alternativnummer: ABB-A10207-20UL,ABB-A10207-100UL,ABB-A10207-500UL,ABB-A10207-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: AWAL, BEC1, TMVCF, TMDVCF, CPETRL1, CLDN5

Produktbeschreibung

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 23kDa
• NCBI: 7122
• UniProt: O00501
• Reinheit: Affinity purification
• Sequenz: LTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV
• Target-Kategorie: CLDN5
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|IHC-P,1:1000 - 1:4000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Tight Junctions,Cytoskeleton

Bilder