HINT1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10221
Artikelname: HINT1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10221
Hersteller Artikelnummer: A10221
Alternativnummer: ABB-A10221-100UL,ABB-A10221-20UL,ABB-A10221-500UL,ABB-A10221-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HINT, NMAN, PKCI-1, PRKCNH1, HINT1
This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed.
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 3094
UniProt: P49773
Reinheit: Affinity purification
Sequenz: MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
Target-Kategorie: HINT1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor suppressors