DMT1/SLC11A2 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10231
Artikelname: DMT1/SLC11A2 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10231
Hersteller Artikelnummer: A10231
Alternativnummer: ABB-A10231-20UL,ABB-A10231-100UL,ABB-A10231-500UL,ABB-A10231-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DCT1, DMT1, AHMIO1, NRAMP2, DMT1/SLC11A2
This gene encodes a member of the solute carrier family 11 protein family. The product of this gene transports divalent metals and is involved in iron absorption. Mutations in this gene are associated with hypochromic microcytic anemia with iron overload. A related solute carrier family 11 protein gene is located on chromosome 2. Multiple transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 4891
UniProt: P49281
Reinheit: Affinity purification
Sequenz: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYS
Target-Kategorie: SLC11A2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cardiovascular,Blood,Serum Proteins