Septin 4 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10238
Artikelname: Septin 4 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10238
Hersteller Artikelnummer: A10238
Alternativnummer: ABB-A10238-100UL,ABB-A10238-20UL,ABB-A10238-1000UL,ABB-A10238-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: H5, ARTS, MART, SEP4, CE5B3, SEPT4, PNUTL2, hucep-7, BRADEION, C17orf47, hCDCREL-2, Septin 4
This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is highly expressed in brain and heart. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. One of the isoforms (known as ARTS) is distinct, it is localized to the mitochondria, and has a role in apoptosis and cancer.
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 5414
UniProt: O43236
Reinheit: Affinity purification
Sequenz: MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSE
Target-Kategorie: SEPTIN4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Cell Cycle,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Immunology Inflammation,Cytokines