Cytokeratin 8 (KRT8) Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Cytokeratin 8 (KRT8) Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1024
• Hersteller Artikelnummer: A1024
• Alternativnummer: ABB-A1024-100UL,ABB-A1024-20UL,ABB-A1024-1000UL,ABB-A1024-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: K8, KO, CK8, CK-8, CYK8, K2C8, CARD2, Cytokeratin 8 (KRT8)

Produktbeschreibung

This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. The product of this gene typically dimerizes with keratin 18 to form an intermediate filament in simple single-layered epithelial cells. This protein plays a role in maintaining cellular structural integrity and also functions in signal transduction and cellular differentiation. Mutations in this gene cause cryptogenic cirrhosis. Alternatively spliced transcript variants have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 54 kDa/56 kDa
• NCBI: 3856
• UniProt: P05787
• Reinheit: Affinity purification
• Sequenz: MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLD
• Target-Kategorie: KRT8
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:2000 - 1:4000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Intermediate Filaments

Bilder