SGK1 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A1025
- Bilder (2)
| Artikelname: | SGK1 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A1025 |
| Hersteller Artikelnummer: | A1025 |
| Alternativnummer: | ABB-A1025-100UL,ABB-A1025-20UL,ABB-A1025-1000UL,ABB-A1025-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SGK, SGK1 |
| This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 49kDa |
| NCBI: | 6446 |
| UniProt: | O00141 |
| Reinheit: | Affinity purification |
| Sequenz: | LYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPP |
| Target-Kategorie: | SGK1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Serine threonine kinases,mTOR Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Stem Cells,Embryonic Stem Cells |
|
|
|
|
|
Produktgarantie und fachkundiger Support
