SGK1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A1025
Article Name: SGK1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1025
Supplier Catalog Number: A1025
Alternative Catalog Number: ABB-A1025-100UL,ABB-A1025-20UL,ABB-A1025-1000UL,ABB-A1025-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SGK, SGK1
This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 6446
UniProt: O00141
Purity: Affinity purification
Sequence: LYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPP
Target: SGK1
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Serine threonine kinases,mTOR Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Stem Cells,Embryonic Stem Cells