TPD52 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10254
Artikelname: TPD52 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10254
Hersteller Artikelnummer: A10254
Alternativnummer: ABB-A10254-20UL,ABB-A10254-100UL,ABB-A10254-1000UL,ABB-A10254-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: D52, N8L, PC-1, PrLZ, hD52, TPD52
Enables calcium ion binding activity and protein homodimerization activity. Involved in B cell differentiation. Located in endoplasmic reticulum and perinuclear region of cytoplasm.
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 7163
UniProt: P55327
Reinheit: Affinity purification
Sequenz: MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
Target-Kategorie: TPD52
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Immunology Inflammation