TPD52 Rabbit pAb, Unconjugated

Product Overview

• Article Name: TPD52 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A10254
• Supplier Catalog Number: A10254
• Alternative Catalog Number: ABB-A10254-20UL,ABB-A10254-100UL,ABB-A10254-1000UL,ABB-A10254-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: D52, N8L, PC-1, PrLZ, hD52, TPD52

Product Description

Enables calcium ion binding activity and protein homodimerization activity. Involved in B cell differentiation. Located in endoplasmic reticulum and perinuclear region of cytoplasm.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 24kDa
• NCBI: 7163
• UniProt: P55327
• Purity: Affinity purification
• Sequence: MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
• Target: TPD52
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Immunology Inflammation

Images