14-3-3 sigma Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: 14-3-3 sigma Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1026
• Hersteller Artikelnummer: A1026
• Alternativnummer: ABB-A1026-100UL,ABB-A1026-20UL,ABB-A1026-500UL,ABB-A1026-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: YWHAS, 14-3-3 sigma

Produktbeschreibung

This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 28kDa
• NCBI: 2810
• UniProt: P31947
• Reinheit: Affinity purification
• Sequenz: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL
• Target-Kategorie: SFN
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Cell Cycle Control-G2 M DNA Damage Checkpoint,Neuroscience, Cell Type Marker,Stem Cells,Neuron marker,Synapse marker

Bilder