14-3-3 sigma Rabbit pAb, Unconjugated

Product Overview

• Article Name: 14-3-3 sigma Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A1026
• Supplier Catalog Number: A1026
• Alternative Catalog Number: ABB-A1026-100UL,ABB-A1026-20UL,ABB-A1026-500UL,ABB-A1026-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: YWHAS, 14-3-3 sigma

Product Description

This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 28kDa
• NCBI: 2810
• UniProt: P31947
• Purity: Affinity purification
• Sequence: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL
• Target: SFN
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Cell Cycle Control-G2 M DNA Damage Checkpoint,Neuroscience, Cell Type Marker,Stem Cells,Neuron marker,Synapse marker

Images