eIF2B epsilon (EIF2B5) Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: eIF2B epsilon (EIF2B5) Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A10263
• Hersteller Artikelnummer: A10263
• Alternativnummer: ABB-A10263-100UL,ABB-A10263-20UL,ABB-A10263-500UL,ABB-A10263-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CLE, CACH, LVWM, EIF-2B, EIF2Bepsilon, eIF2B epsilon (EIF2B5)

Produktbeschreibung

This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 80kDa
• NCBI: 8893
• UniProt: Q13144
• Reinheit: Affinity purification
• Sequenz: TLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKMKGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDSRGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQ
• Target-Kategorie: EIF2B5
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Endocrine Metabolism,Insulin Receptor Signaling Pathway

Bilder