eIF2B epsilon (EIF2B5) Rabbit pAb, Unconjugated

Product Overview

• Article Name: eIF2B epsilon (EIF2B5) Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A10263
• Supplier Catalog Number: A10263
• Alternative Catalog Number: ABB-A10263-100UL,ABB-A10263-20UL,ABB-A10263-500UL,ABB-A10263-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IP, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CLE, CACH, LVWM, EIF-2B, EIF2Bepsilon, eIF2B epsilon (EIF2B5)

Product Description

This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 80kDa
• NCBI: 8893
• UniProt: Q13144
• Purity: Affinity purification
• Sequence: TLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKMKGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDSRGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQ
• Target: EIF2B5
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Endocrine Metabolism,Insulin Receptor Signaling Pathway

Images