GADD45G Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: GADD45G Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A10286
• Hersteller Artikelnummer: A10286
• Alternativnummer: ABB-A10286-20UL,ABB-A10286-100UL,ABB-A10286-500UL,ABB-A10286-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CR6, DDIT2, GRP17, GADD45gamma, GADD45G

Produktbeschreibung

This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 17kDa
• NCBI: 10912
• UniProt: O95257
• Reinheit: Affinity purification
• Sequenz: IDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
• Target-Kategorie: GADD45G
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Centrosome