GADD45G Rabbit pAb, Unconjugated

Product Overview

• Article Name: GADD45G Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A10286
• Supplier Catalog Number: A10286
• Alternative Catalog Number: ABB-A10286-20UL,ABB-A10286-100UL,ABB-A10286-500UL,ABB-A10286-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CR6, DDIT2, GRP17, GADD45gamma, GADD45G

Product Description

This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 17kDa
• NCBI: 10912
• UniProt: O95257
• Purity: Affinity purification
• Sequence: IDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
• Target: GADD45G
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Centrosome