ICMT Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10293
Artikelname: ICMT Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10293
Hersteller Artikelnummer: A10293
Alternativnummer: ABB-A10293-100UL,ABB-A10293-20UL,ABB-A10293-1000UL,ABB-A10293-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PCMT, PPMT, PCCMT, HSTE14, MST098, MSTP098, ICMT
This gene encodes the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. Alternative splicing may result in other transcript variants, but the biological validity of those transcripts has not been determined.
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 23463
UniProt: O60725
Reinheit: Affinity purification
Sequenz: KAAMFTAGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTVWRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKGVKVDL
Target-Kategorie: ICMT
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology