ICMT Rabbit pAb, Unconjugated

Catalog Number: ABB-A10293
Article Name: ICMT Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10293
Supplier Catalog Number: A10293
Alternative Catalog Number: ABB-A10293-100UL,ABB-A10293-20UL,ABB-A10293-1000UL,ABB-A10293-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PCMT, PPMT, PCCMT, HSTE14, MST098, MSTP098, ICMT
This gene encodes the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. Alternative splicing may result in other transcript variants, but the biological validity of those transcripts has not been determined.
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 23463
UniProt: O60725
Purity: Affinity purification
Sequence: KAAMFTAGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTVWRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKGVKVDL
Target: ICMT
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology