CISD1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: CISD1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A10317
• Hersteller Artikelnummer: A10317
• Alternativnummer: ABB-A10317-100UL,ABB-A10317-20UL,ABB-A10317-500UL,ABB-A10317-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ZCD1, MDS029, C10orf70, mitoNEET, CISD1

Produktbeschreibung

This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 12kDa
• NCBI: 55847
• UniProt: Q9NZ45
• Reinheit: Affinity purification
• Sequenz: LAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
• Target-Kategorie: CISD1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers

Bilder