CISD1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: CISD1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A10317
• Supplier Catalog Number: A10317
• Alternative Catalog Number: ABB-A10317-100UL,ABB-A10317-20UL,ABB-A10317-500UL,ABB-A10317-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ZCD1, MDS029, C10orf70, mitoNEET, CISD1

Product Description

This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 12kDa
• NCBI: 55847
• UniProt: Q9NZ45
• Purity: Affinity purification
• Sequence: LAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
• Target: CISD1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers

Images