MMP16 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10409
Artikelname: MMP16 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10409
Hersteller Artikelnummer: A10409
Alternativnummer: ABB-A10409-100UL,ABB-A10409-20UL,ABB-A10409-1000UL,ABB-A10409-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MMP-X2, C8orf57, MT-MMP2, MT-MMP3, MT3-MMP, MMP16
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein activates MMP2 by cleavage. This gene was once referred to as MT-MMP2, but was renamed as MT-MMP3 or MMP16.
Klonalität: Polyclonal
Molekulargewicht: 70kDa
NCBI: 4325
UniProt: P51512
Reinheit: Affinity purification
Sequenz: YGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVKEGHS
Target-Kategorie: MMP16
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Extracellular Matrix,Ubiquitin,Cardiovascular,Angiogenesis