MMP16 Rabbit pAb, Unconjugated

Catalog Number: ABB-A10409
Article Name: MMP16 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10409
Supplier Catalog Number: A10409
Alternative Catalog Number: ABB-A10409-100UL,ABB-A10409-20UL,ABB-A10409-1000UL,ABB-A10409-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MMP-X2, C8orf57, MT-MMP2, MT-MMP3, MT3-MMP, MMP16
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein activates MMP2 by cleavage. This gene was once referred to as MT-MMP2, but was renamed as MT-MMP3 or MMP16.
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 4325
UniProt: P51512
Purity: Affinity purification
Sequence: YGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVKEGHS
Target: MMP16
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Extracellular Matrix,Ubiquitin,Cardiovascular,Angiogenesis