SLC4A5 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10436
Artikelname: SLC4A5 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10436
Hersteller Artikelnummer: A10436
Alternativnummer: ABB-A10436-100UL,ABB-A10436-20UL,ABB-A10436-1000UL,ABB-A10436-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: NBC4, NBCe2, SLC4A5
This gene encodes a member of the sodium bicarbonate cotransporter (NBC) family, part of the bicarbonate transporter superfamily. Sodium bicarbonate cotransporters are involved in intracellular pH regulation and electroneural or electrogenic sodium bicarbonate transport. This protein is thought to be an integral membrane protein. Multiple transcript variants encoding different isoforms have been found for this gene, but the biological validity of some variants has not been determined.
Klonalität: Polyclonal
Molekulargewicht: 126kDa
NCBI: 57835
UniProt: Q9BY07
Reinheit: Affinity purification
Sequenz: DFIFSQHDLAWIDNILPEKEKKETDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL
Target-Kategorie: SLC4A5
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience