SLC4A5 Rabbit pAb, Unconjugated

Catalog Number: ABB-A10436
Article Name: SLC4A5 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10436
Supplier Catalog Number: A10436
Alternative Catalog Number: ABB-A10436-100UL,ABB-A10436-20UL,ABB-A10436-1000UL,ABB-A10436-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: NBC4, NBCe2, SLC4A5
This gene encodes a member of the sodium bicarbonate cotransporter (NBC) family, part of the bicarbonate transporter superfamily. Sodium bicarbonate cotransporters are involved in intracellular pH regulation and electroneural or electrogenic sodium bicarbonate transport. This protein is thought to be an integral membrane protein. Multiple transcript variants encoding different isoforms have been found for this gene, but the biological validity of some variants has not been determined.
Clonality: Polyclonal
Molecular Weight: 126kDa
NCBI: 57835
UniProt: Q9BY07
Purity: Affinity purification
Sequence: DFIFSQHDLAWIDNILPEKEKKETDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL
Target: SLC4A5
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience