EXOSC2 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10450
Artikelname: EXOSC2 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10450
Hersteller Artikelnummer: A10450
Alternativnummer: ABB-A10450-100UL,ABB-A10450-20UL,ABB-A10450-500UL,ABB-A10450-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: p7, RRP4, SHRF, Rrp4p, hRrp4p, EXOSC2
Predicted to enable RNA binding activity. Involved in positive regulation of cell growth. Located in cytoplasm, nucleolus, and nucleoplasm. Part of nuclear exosome (RNase complex).
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 23404
UniProt: Q13868
Reinheit: Affinity purification
Sequenz: MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTS
Target-Kategorie: EXOSC2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling