EXOSC2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: EXOSC2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A10450
• Supplier Catalog Number: A10450
• Alternative Catalog Number: ABB-A10450-100UL,ABB-A10450-20UL,ABB-A10450-500UL,ABB-A10450-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: p7, RRP4, SHRF, Rrp4p, hRrp4p, EXOSC2

Product Description

Predicted to enable RNA binding activity. Involved in positive regulation of cell growth. Located in cytoplasm, nucleolus, and nucleoplasm. Part of nuclear exosome (RNase complex).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 33kDa
• NCBI: 23404
• UniProt: Q13868
• Purity: Affinity purification
• Sequence: MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTS
• Target: EXOSC2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling

Images