[KO Validated] HK1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: [KO Validated] HK1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1054
• Hersteller Artikelnummer: A1054
• Alternativnummer: ABB-A1054-100UL,ABB-A1054-20UL,ABB-A1054-1000UL,ABB-A1054-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HK, HKD, HKI, HXK1, NMSR, RP79, HMSNR, HK1-ta, HK1-tb, HK1-tc, NEDVIBA, hexokinase, K1

Produktbeschreibung

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in several transcript variants which encode different isoforms, some of which are tissue-specific.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 102kDa
• NCBI: 3098
• UniProt: P19367
• Reinheit: Affinity purification
• Sequenz: KIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGY
• Target-Kategorie: HK1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Carbohydrate metabolism,Warburg Effect,Cardiovascular,Blood,Heart

Bilder