[KO Validated] HK1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A1054
Article Name: [KO Validated] HK1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1054
Supplier Catalog Number: A1054
Alternative Catalog Number: ABB-A1054-100UL,ABB-A1054-20UL,ABB-A1054-1000UL,ABB-A1054-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HK, HKD, HKI, HXK1, NMSR, RP79, HMSNR, HK1-ta, HK1-tb, HK1-tc, NEDVIBA, hexokinase, K1
Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in several transcript variants which encode different isoforms, some of which are tissue-specific.
Clonality: Polyclonal
Molecular Weight: 102kDa
NCBI: 3098
UniProt: P19367
Purity: Affinity purification
Sequence: KIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGY
Target: HK1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Carbohydrate metabolism,Warburg Effect,Cardiovascular,Blood,Heart