VDAC3 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10544
Artikelname: VDAC3 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10544
Hersteller Artikelnummer: A10544
Alternativnummer: ABB-A10544-100UL,ABB-A10544-20UL,ABB-A10544-1000UL,ABB-A10544-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: VDAC-3, HD-VDAC3, VDAC3
This gene encodes a voltage-dependent anion channel (VDAC), and belongs to the mitochondrial porin family. VDACs are small, integral membrane proteins that traverse the outer mitochondrial membrane and conduct ATP and other small metabolites. They are known to bind several kinases of intermediary metabolism, thought to be involved in translocation of adenine nucleotides, and are hypothesized to form part of the mitochondrial permeability transition pore, which results in the release of cytochrome c at the onset of apoptotic cell death. Alternatively transcript variants encoding different isoforms have been described for this gene.
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 7419
UniProt: Q9Y277
Reinheit: Affinity purification
Sequenz: MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTRFGIAAKYMLDCRTSLSAKVNNASLIGLGYTQTLRPGV
Target-Kategorie: VDAC3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Warburg Effect,Neuroscience,Neurodegenerative Diseases