VDAC3 Rabbit pAb, Unconjugated

Catalog Number: ABB-A10544
Article Name: VDAC3 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10544
Supplier Catalog Number: A10544
Alternative Catalog Number: ABB-A10544-100UL,ABB-A10544-20UL,ABB-A10544-1000UL,ABB-A10544-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: VDAC-3, HD-VDAC3, VDAC3
This gene encodes a voltage-dependent anion channel (VDAC), and belongs to the mitochondrial porin family. VDACs are small, integral membrane proteins that traverse the outer mitochondrial membrane and conduct ATP and other small metabolites. They are known to bind several kinases of intermediary metabolism, thought to be involved in translocation of adenine nucleotides, and are hypothesized to form part of the mitochondrial permeability transition pore, which results in the release of cytochrome c at the onset of apoptotic cell death. Alternatively transcript variants encoding different isoforms have been described for this gene.
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 7419
UniProt: Q9Y277
Purity: Affinity purification
Sequence: MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTRFGIAAKYMLDCRTSLSAKVNNASLIGLGYTQTLRPGV
Target: VDAC3
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Warburg Effect,Neuroscience,Neurodegenerative Diseases