MCT4/SLC16A3 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10548
Artikelname: MCT4/SLC16A3 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10548
Hersteller Artikelnummer: A10548
Alternativnummer: ABB-A10548-100UL,ABB-A10548-20UL,ABB-A10548-1000UL,ABB-A10548-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MCT3, MCT4, MCT 3, MCT 4, MCT-3, MCT-4, MCT4/SLC16A3
Lactic acid and pyruvate transport across plasma membranes is catalyzed by members of the proton-linked monocarboxylate transporter (MCT) family, which has been designated solute carrier family-16. Each MCT appears to have slightly different substrate and inhibitor specificities and transport kinetics, which are related to the metabolic requirements of the tissues in which it is found. The MCTs, which include MCT1 (SLC16A1, MIM 600682) and MCT2 (SLC16A7, MIM 603654), are characterized by 12 predicted transmembrane domains (Price et al., 1998 [PubMed 9425115]).
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 9123
UniProt: O15427
Reinheit: Affinity purification
Sequenz: IRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV
Target-Kategorie: SLC16A3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding