MCT4/SLC16A3 Rabbit pAb, Unconjugated

Catalog Number: ABB-A10548
Article Name: MCT4/SLC16A3 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10548
Supplier Catalog Number: A10548
Alternative Catalog Number: ABB-A10548-100UL,ABB-A10548-20UL,ABB-A10548-1000UL,ABB-A10548-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MCT3, MCT4, MCT 3, MCT 4, MCT-3, MCT-4, MCT4/SLC16A3
Lactic acid and pyruvate transport across plasma membranes is catalyzed by members of the proton-linked monocarboxylate transporter (MCT) family, which has been designated solute carrier family-16. Each MCT appears to have slightly different substrate and inhibitor specificities and transport kinetics, which are related to the metabolic requirements of the tissues in which it is found. The MCTs, which include MCT1 (SLC16A1, MIM 600682) and MCT2 (SLC16A7, MIM 603654), are characterized by 12 predicted transmembrane domains (Price et al., 1998 [PubMed 9425115]).
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 9123
UniProt: O15427
Purity: Affinity purification
Sequence: IRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV
Target: SLC16A3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding