PRMT1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A1055
Artikelname: PRMT1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A1055
Hersteller Artikelnummer: A1055
Alternativnummer: ABB-A1055-100UL,ABB-A1055-20UL,ABB-A1055-500UL,ABB-A1055-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ANM1, HCP1, IR1B4, HRMT1L2, PRMT1
This gene encodes a member of the protein arginine N-methyltransferase (PRMT) family. Post-translational modification of target proteins by PRMTs plays an important regulatory role in many biological processes, whereby PRMTs methylate arginine residues by transferring methyl groups from S-adenosyl-L-methionine to terminal guanidino nitrogen atoms. The encoded protein is a type I PRMT and is responsible for the majority of cellular arginine methylation activity. Increased expression of this gene may play a role in many types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5.
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 3276
UniProt: Q99873
Reinheit: Affinity purification
Sequenz: PFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR
Target-Kategorie: PRMT1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Nuclear Receptor Signaling,Cancer,Tumor suppressors,p53 pathway,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors