PRMT1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A1055
Article Name: PRMT1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1055
Supplier Catalog Number: A1055
Alternative Catalog Number: ABB-A1055-100UL,ABB-A1055-20UL,ABB-A1055-500UL,ABB-A1055-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ANM1, HCP1, IR1B4, HRMT1L2, PRMT1
This gene encodes a member of the protein arginine N-methyltransferase (PRMT) family. Post-translational modification of target proteins by PRMTs plays an important regulatory role in many biological processes, whereby PRMTs methylate arginine residues by transferring methyl groups from S-adenosyl-L-methionine to terminal guanidino nitrogen atoms. The encoded protein is a type I PRMT and is responsible for the majority of cellular arginine methylation activity. Increased expression of this gene may play a role in many types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5.
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 3276
UniProt: Q99873
Purity: Affinity purification
Sequence: PFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR
Target: PRMT1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Nuclear Receptor Signaling,Cancer,Tumor suppressors,p53 pathway,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors