SEC11A Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: SEC11A Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A10552
• Hersteller Artikelnummer: A10552
• Alternativnummer: ABB-A10552-100UL,ABB-A10552-20UL,ABB-A10552-1000UL,ABB-A10552-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: SPC18, SPCS4A, SEC11L1, sid2895, 1810012E07Rik, SEC11A

Produktbeschreibung

This gene encodes a member of the peptidase S26B family. The encoded protein is an 18kDa subunit of the signal peptidase complex and has been linked to cell migration and invasion, gastric cancer and lymph node metastasis. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 8.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 21kDa
• NCBI: 23478
• UniProt: P67812
• Reinheit: Affinity purification
• Sequenz: KGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGF
• Target-Kategorie: SEC11A
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology

Bilder