SEC11A Rabbit pAb, Unconjugated

Product Overview

• Article Name: SEC11A Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A10552
• Supplier Catalog Number: A10552
• Alternative Catalog Number: ABB-A10552-100UL,ABB-A10552-20UL,ABB-A10552-1000UL,ABB-A10552-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SPC18, SPCS4A, SEC11L1, sid2895, 1810012E07Rik, SEC11A

Product Description

This gene encodes a member of the peptidase S26B family. The encoded protein is an 18kDa subunit of the signal peptidase complex and has been linked to cell migration and invasion, gastric cancer and lymph node metastasis. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 8.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 21kDa
• NCBI: 23478
• UniProt: P67812
• Purity: Affinity purification
• Sequence: KGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGF
• Target: SEC11A
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology

Images