COL11A1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: COL11A1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A10559
• Hersteller Artikelnummer: A10559
• Alternativnummer: ABB-A10559-100UL,ABB-A10559-20UL,ABB-A10559-500UL,ABB-A10559-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: STL2, COLL6, CO11A1, DFNA37, COL11A1

Produktbeschreibung

This gene encodes one of the two alpha chains of type XI collagen, a minor fibrillar collagen. Type XI collagen is a heterotrimer but the third alpha chain is a post-translationally modified alpha 1 type II chain. Mutations in this gene are associated with type II Stickler syndrome and with Marshall syndrome. A single-nucleotide polymorphism in this gene is also associated with susceptibility to lumbar disc herniation. Multiple transcript variants have been identified for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 181kDa
• NCBI: 1301
• UniProt: P12107
• Reinheit: Affinity purification
• Sequenz: EKKKSNFKKKMRTVATKSKEKSKKFTPPKSEKFSSKKKKSYQASAKAKLGVKANIVDDFQEYNYGTMESYQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDYDSQRKNSEDTLYENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPPNEEFGPGVPAETDITETSING
• Target-Kategorie: COL11A1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat

Bilder