COL11A1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A10559
Article Name: COL11A1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10559
Supplier Catalog Number: A10559
Alternative Catalog Number: ABB-A10559-100UL,ABB-A10559-20UL,ABB-A10559-500UL,ABB-A10559-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: STL2, COLL6, CO11A1, DFNA37, COL11A1
This gene encodes one of the two alpha chains of type XI collagen, a minor fibrillar collagen. Type XI collagen is a heterotrimer but the third alpha chain is a post-translationally modified alpha 1 type II chain. Mutations in this gene are associated with type II Stickler syndrome and with Marshall syndrome. A single-nucleotide polymorphism in this gene is also associated with susceptibility to lumbar disc herniation. Multiple transcript variants have been identified for this gene.
Clonality: Polyclonal
Molecular Weight: 181kDa
NCBI: 1301
UniProt: P12107
Purity: Affinity purification
Sequence: EKKKSNFKKKMRTVATKSKEKSKKFTPPKSEKFSSKKKKSYQASAKAKLGVKANIVDDFQEYNYGTMESYQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDYDSQRKNSEDTLYENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPPNEEFGPGVPAETDITETSING
Target: COL11A1
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat