[KD Validated] MLST8 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: [KD Validated] MLST8 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1059
• Hersteller Artikelnummer: A1059
• Alternativnummer: ABB-A1059-100UL,ABB-A1059-20UL,ABB-A1059-1000UL,ABB-A1059-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: GBL, LST8, POP3, WAT1, GbetaL, [KD Validated] MLST8

Produktbeschreibung

Enables protein serine/threonine kinase activator activity. Involved in TORC1 signaling, positive regulation of TOR signaling, and regulation of actin cytoskeleton organization. Part of TORC1 complex and TORC2 complex.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 36kDa
• NCBI: 64223
• UniProt: Q9BVC4
• Reinheit: Affinity purification
• Sequenz: MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLM
• Target-Kategorie: MLST8
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Signal Transduction,G protein signaling,Small G proteins,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Immunology Inflammation,T Cell Receptor Signaling Pathway

Bilder