[KD Validated] MLST8 Rabbit pAb, Unconjugated

Product Overview

• Article Name: [KD Validated] MLST8 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A1059
• Supplier Catalog Number: A1059
• Alternative Catalog Number: ABB-A1059-100UL,ABB-A1059-20UL,ABB-A1059-1000UL,ABB-A1059-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: GBL, LST8, POP3, WAT1, GbetaL, [KD Validated] MLST8

Product Description

Enables protein serine/threonine kinase activator activity. Involved in TORC1 signaling, positive regulation of TOR signaling, and regulation of actin cytoskeleton organization. Part of TORC1 complex and TORC2 complex.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 36kDa
• NCBI: 64223
• UniProt: Q9BVC4
• Purity: Affinity purification
• Sequence: MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLM
• Target: MLST8
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Signal Transduction,G protein signaling,Small G proteins,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Immunology Inflammation,T Cell Receptor Signaling Pathway

Images