GCGR Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10617
Artikelname: GCGR Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10617
Hersteller Artikelnummer: A10617
Alternativnummer: ABB-A10617-100UL,ABB-A10617-20UL,ABB-A10617-500UL,ABB-A10617-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GGR, GL-R, MVAH, GCGR
The protein encoded by this gene is a glucagon receptor that is important in controlling blood glucose levels. Defects in this gene are a cause of non-insulin-dependent diabetes mellitus (NIDDM).
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 2642
UniProt: P47871
Reinheit: Affinity purification
Sequenz: LPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSFQVMYTVGYS
Target-Kategorie: GCGR
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism