GCGR Rabbit pAb, Unconjugated

Product Overview

• Article Name: GCGR Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A10617
• Supplier Catalog Number: A10617
• Alternative Catalog Number: ABB-A10617-100UL,ABB-A10617-20UL,ABB-A10617-500UL,ABB-A10617-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: GGR, GL-R, MVAH, GCGR

Product Description

The protein encoded by this gene is a glucagon receptor that is important in controlling blood glucose levels. Defects in this gene are a cause of non-insulin-dependent diabetes mellitus (NIDDM).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 54kDa
• NCBI: 2642
• UniProt: P47871
• Purity: Affinity purification
• Sequence: LPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSFQVMYTVGYS
• Target: GCGR
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism

Images