TDGF1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A1065
Artikelname: TDGF1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A1065
Hersteller Artikelnummer: A1065
Alternativnummer: ABB-A1065-100UL,ABB-A1065-20UL,ABB-A1065-1000UL,ABB-A1065-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CR, CR-1, CRGF, CRIPTO, TDGF1
This gene encodes an epidermal growth factor-related protein that contains a cripto, FRL-1, and cryptic domain. The encoded protein is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. Pseudogenes of this gene are found on chromosomes 2, 3, 6, 8, 19 and X. Alternate splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 6997
UniProt: P13385
Reinheit: Affinity purification
Sequenz: RDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPEL
Target-Kategorie: TDGF1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Growth factors,Stem Cells,Embryonic Stem Cells